Protein Info for Echvi_1394 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: chromate transporter, chromate ion transporter (CHR) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 82 to 105 (24 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 143 to 175 (33 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 322 to 350 (29 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 430 to 448 (19 residues), see Phobius details PF02417: Chromate_transp" amino acids 10 to 174 (165 residues), 142.3 bits, see alignment E=7.3e-46 amino acids 249 to 442 (194 residues), 117.9 bits, see alignment E=2.4e-38 TIGR00937: chromate efflux transporter" amino acids 17 to 421 (405 residues), 218 bits, see alignment E=1.5e-68

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 80% identity to zpr:ZPR_1483)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWI2 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Echvi_1394 chromate transporter, chromate ion transporter (CHR) family (Echinicola vietnamensis KMM 6221, DSM 17526)
MIDKQVSFKEAFKVWVRVAIHSFGGPAGQIAVIHKILVEEKKWISENRFLHALNYCMLLP
GPEAQQLATYIGWLLHRSKGGLVAGILFVLPGFISILILSILYAAYRDIGIVEAIFFGIK
PAVLAIVIGAVIKIGKRALKNEVMVTMAALAFVAIFFFQVDFPYIVVVAGLTGFIGGKLW
EEKFYVIKGHGEKSEEESAYFIDSHIRPVKPSLVKTLKTVFLFFSLWALPLVLIALWVGV
ENIFFSEGLFFSKTAVVTFGGAYSVLAYIAQKAVEDYGWLKSGEMLDGLGMAETTPGPLI
QVVQFVGFMGAYRFAGSLDPMMAGILASILVTWTTFIPCFLFIFTGAPYIEYLRGNKNLT
TALSGITAAVVGVVLNLGVWFALHTLFGKVNESHSLGIRWLIPEWATIDVPSLVIGLIAA
FVYFILKWEMLKTILVSVICGILYYFTFL