Protein Info for Echvi_1321 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pectate lyase, PelA/Pel-15E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF09492: Pec_lyase" amino acids 56 to 347 (292 residues), 382.6 bits, see alignment E=6.6e-119 TIGR02474: pectate lyase" amino acids 56 to 346 (291 residues), 352 bits, see alignment E=1.7e-109

Best Hits

KEGG orthology group: None (inferred from 44% identity to phe:Phep_1159)

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWC1 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Echvi_1321 pectate lyase, PelA/Pel-15E family (Echinicola vietnamensis KMM 6221, DSM 17526)
MFRYLYLALALTWSASTMAQTQDEEHLSWRAAQRQDQEWFDSKEAQRIADNVLLYQHENG
GWYKNIDMASKLSKDEKEKLLEEKNKDLGTTIDNGATISQLEYLAKVYAATQEERYKIAF
LSGIDYLLEAQYENGGWPQYYPVRKGYYQHITYNDNAMIGVMRLLRKVAEGEMPYDFVGT
KRKKAAKVALDKGLEVILATQVKINGQLTIWCAQHDEVSLAPAKARAYELPSLSGSESVN
IVRYLMHLPDPTPEVVTAVESAIAWFENHKIKDKAVQRIKDPSLAKGYDLVVVDQPGASP
LWARFYDLDTQQPFYVGRDGIKRTQLKDIEYERRVGYSYLGNYAEGLLEKEYPRWKQGL