Protein Info for Echvi_1314 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 16S RNA G1207 methylase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF13489: Methyltransf_23" amino acids 96 to 246 (151 residues), 85.5 bits, see alignment E=8.8e-28 PF13847: Methyltransf_31" amino acids 113 to 207 (95 residues), 35.8 bits, see alignment E=1.6e-12 PF13649: Methyltransf_25" amino acids 114 to 197 (84 residues), 37.3 bits, see alignment E=9.3e-13 PF08242: Methyltransf_12" amino acids 115 to 199 (85 residues), 44.9 bits, see alignment E=4.1e-15 PF08241: Methyltransf_11" amino acids 115 to 201 (87 residues), 40.3 bits, see alignment E=1.1e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY77 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Echvi_1314 16S RNA G1207 methylase RsmC (Echinicola vietnamensis KMM 6221, DSM 17526)
METPSDASCTLCGNHRANKLHVVREMMFGTRDEFTYLECSDCQAIQLTSLPDDLGTYYPA
DYYSLGEINLSSWPVRRLKQLRYALFRLTNMNIFKHYHYGDWLEKLALPLDSSILDLGCG
NGQLLYELFPCGHTNLVGMDPFMEKSQRINQHIRLLKKSIYEVEEKFDCIMMHHSFEHMD
QPKAVIDRAVELLNPNGKLLIRIPVAQKAAWKTYGTDWVQLDAPRHLFIHSETSLKKLTE
DTGLRLDRIIYDSTAFQFTGSEMYRRNIPFHQSNEAAIFTAEERQEFRVKAQVLNQQQEG
DQACFYFSKRQDKQ