Protein Info for Echvi_1309 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein related to plant photosystem II stability/assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 933 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF14870: PSII_BNR" amino acids 62 to 188 (127 residues), 72.3 bits, see alignment E=8.8e-24 amino acids 184 to 313 (130 residues), 38.8 bits, see alignment E=1.4e-13 amino acids 322 to 399 (78 residues), 29.3 bits, see alignment E=1e-10 amino acids 393 to 517 (125 residues), 28.7 bits, see alignment E=1.7e-10 amino acids 512 to 587 (76 residues), 36.2 bits, see alignment E=8.5e-13 PF19408: PKD_6" amino acids 596 to 675 (80 residues), 37.8 bits, see alignment E=4.2e-13 amino acids 682 to 756 (75 residues), 40.9 bits, see alignment E=4.3e-14 amino acids 765 to 842 (78 residues), 37.9 bits, see alignment E=3.9e-13 PF18962: Por_Secre_tail" amino acids 860 to 933 (74 residues), 38.1 bits, see alignment E=2.8e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY75 at UniProt or InterPro

Protein Sequence (933 amino acids)

>Echvi_1309 Uncharacterized protein related to plant photosystem II stability/assembly factor (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNPLLLVIFCLSLVQTAFSQSWQRITDRGNALTDIHWVNDDLAFASGNQIMLKTTDGGE
GWTELAMPIAADLLAVDFHDHQIGAMAGKNGTLLQTKDGGQSWNIINLNTTSDILTVNYR
SSEEIWISGTSGTLKYSSNGGETWTSVELGTTAAINTLVFTSGDQGFLATSSGAIYKTTN
NGQSWQQLTSSVSTALNDLYFTNDTTGYAVGDEGTILKTVDSGNHWAFIQSGTNYDYKRV
AFHRDRPDIGIIVGEEGTVLYTNNAGLTFLVRNSRTTEDIHGIDYKQSTNTVVAVADGGT
ILRSTNAGSSWISLLSGHPSDFLATDFVNDSRGYIAGKEAVIFRTTNGGDSFNDYSRPLN
IDFHAIAFQSPAFGYVVGDDGTMLNTTNSGGSWTALNPKTELDLYGLYFADADTGYIVGE
SGYLASTVNRGVNWSTIHAGDKGYDYHDIDFFESGPGIIIGEGGHVLKSNSNGDWQEISI
GTSDDLHGMFMIDESAAIIVGDNGQAFFTQNQFESWEPLNTNTAQNLRDVAFLDSLTGFI
VGDKGLILQTTDRGKNWTEVDTETYQDFKAISFGDVNTGYAVGEFGMIYQYSCEVPTATG
TIIGQDNICLSQQIYRLEYESTDDLTFEWRVDGGTIIEGQGSDRIVVQWETPGRNAVLVK
SQNICGDGPTEGLEVTVSTIPEKVPQIIGNGVACLETVSQYEVDSIPGMEYIWTASGGII
QSGQGTAHAAITWEAEGQQQLKVMPRNACGESTATTKAITITRAPSQPDPIIGLAEVGLE
VQSYEVSEVEGVNYQWSTEGGTILSGQGTHAVTVSWEKEGDFLLEVTPSNHCHEGIPQAL
NVNVNLITDLEKEAEKAQVKIYPNPSSGDIHINIKGVGSIREIRIVDPMGKYLRKITPHG
DMFDFDIENLPVGLWLIEVESTAGKSVDKVWIK