Protein Info for Echvi_1295 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): diaminopimelate decarboxylase (EC 4.1.1.20)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01048.
Original annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 5 to 405 (401 residues), 388.4 bits, E=1.6e-120
• PF00278: Orn_DAP_Arg_deC
  • amino acids 27 to 363 (337 residues), 72.2 bits, E=3.5e-24
• PF02784: Orn_Arg_deC_N
  • amino acids 33 to 275 (243 residues), 163 bits, E=8.6e-52

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 64% identity to mtt:Ftrac_2161)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• aspartate superpathway (20/25 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See L0FXV1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Echvi_1295 diaminopimelate decarboxylase (EC 4.1.1.20) (Echinicola vietnamensis KMM 6221, DSM 17526)
MTIDNQQYQVQGVPLLDIASEYGTPVYVYDGQKILDQVATLQNAFSSVNLKIKYATKALS
NINILKLMKKAGTGVDAVSIEEVKLCLHVGYEPSEIMFTPNCVAFEEIQEAVDLGVMINI
DNIPMLEHFGTYYGNSVPLCIRLNPHILAGGNAKISVGHIDSKFGISILQLKHVLKIVEV
HNLKVAGLHVHTGSDILDAEVFLKGAEILFDAAKEFKDLQFLDFGGGFKVGYKEGDITTD
MVEVGRKVSAAFKEFCKNYGRELEIWFEPGKFLVSECGYLLVNANVVKSTPASTFIGVDS
GLNHLIRPMMYDAYHGVENISRVTGPDRVYTIVGYICETDTIAADRKLKEVKEGDVLAIK
NAGAYGFSMASNYNSRLRPAEVLVLDGKAHLIRARESFEDILRHQIDIGL