Protein Info for Echvi_1286 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transketolase, N-terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00456: Transketolase_N
  • amino acids 16 to 266 (251 residues), 161.8 bits, E=5.7e-51
• PF09364: XFP_N
  • amino acids 98 to 218 (121 residues), 25.9 bits, E=1.1e-09
• PF00676: E1_dh
  • amino acids 109 to 221 (113 residues), 37.8 bits, E=2.9e-13
• PF02775: TPP_enzyme_C
  • amino acids 110 to 231 (122 residues), 22.8 bits, E=1.7e-08

Best Hits

Swiss-Prot: 48% identical to APTA_BACV8: Apulose-4-phosphate transketolase subunit A (aptA) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 74% identity to phe:Phep_2799)

MetaCyc: 48% identical to apulose-4-phosphate transketolase subunit A (Actinobacillus succinogenes 130Z)
RXN-20930 [EC: 2.2.1.13]

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• Bifidobacterium shunt (11/15 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• D-apiose degradation I (1/3 steps found)
• oxygenic photosynthesis (11/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1 or 2.2.1.13

Sequence Analysis Tools

See L0FW90 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Echvi_1286 Transketolase, N-terminal subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTKELEIKSLNYRKKVLQYIKKANAGHTGGSLSCTDILNVLYNEVMNVSPENFSDPNRD
RYIQSKGHSVEALFVVLADQGFYPESEIETLCQYRSHFIGHPTRKVPGVEQNTGALGHGL
PISVGTALAGKMDGLDYRVFTMMGDGELLEGSNWEAAMAAAHYKLDNLVAILDYNKLQIT
GAVKDVCNSEPIDQKFEAFGWSVKHVDGNDVEALSQTLKSAPFEAGKPSFVIAHTIKGKG
ISFMENNIKWHHGVPSDEQYAAAQKELDGQLEELSKALTS