Protein Info for Echvi_1280 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 308 (274 residues), 159.3 bits, see alignment E=5.4e-51

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 77% identity to phe:Phep_2804)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXU0 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components (Echinicola vietnamensis KMM 6221, DSM 17526)
MPSIAKFQSLIALIILCLVLSLLSDRFLTLANGWNVMRQVSVNICISVGMTLVILTAGID
LSVGSILALCGAVTASLIKNGIAVEGLNLHIGFAPLGAVILGVGLGFGLGWFNGWTITRF
KVPPFVATLAMLTIARGLTMLWTGGFPINGLGEDFAFLGTGWFLGIPMPVWITAVIVALA
VLLTKKTKFGRYVYAIGGNERAARLSGINISRVKMTVYAIAGGLAAVGGMIVTSRLDSAQ
PNAGISYELDAIAAVVIGGTSLSGGKGTIMGAVLGGIIIGVLNNGLVLLNVSPFWQQVVK
GAVILLAVVIDKANSKED