Protein Info for Echvi_1279 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00370: FGGY_N" amino acids 8 to 256 (249 residues), 210.6 bits, see alignment E=2.9e-66 PF02782: FGGY_C" amino acids 266 to 453 (188 residues), 120.6 bits, see alignment E=7.9e-39

Best Hits

Swiss-Prot: 45% identical to GLPK_DESHD: Glycerol kinase (glpK) from Desulfitobacterium hafniense (strain DCB-2 / DSM 10664)

KEGG orthology group: None (inferred from 65% identity to phe:Phep_2805)

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.30

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY47 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Echvi_1279 Glycerol kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDSNKQFILSIDQGTSGTKALVFDAQGKQVAKATVPLKTHYLDGGLVEQDPEDIYQNVLK
AVGICLADFQFQGHPLDAITSCGISNQRETFLLWDKNGAPLYQAVVWQCKRSIGVCDRLK
AAGLEPLIKDKTGLIIDPYFSGTKLIWLYENDPAIATAIDAGEAYFGTVDTWLLYRLTEG
NHYLTDFTNASRTLFFNLDTLDWDRELLDNMGLSGLQLPAVRPSSAEFGVTDFEGLLDAP
LPIFAMIGDSHAAAFGEACFEPGTAKATMGTGCSVLMNVGDERKSSGHGMVSTICWSTEA
QVSYALEGVIVTCGATIEWLKNELGLIQDSRETEAMAKAVTSNQGVYLVPAFSGLGAPHW
DMKRKASLVGMTFDSGKNHIVRAALESIPYQIKDVISAMEEDAQLDLEALNVDGGITANG
FVIDFLADLLEKPVARVGIADVSALGAAYLAGLKAGVFKDLAHLQQLQQKQQTVPNGPAD
SIKAAYAGWQRAVKGNTDNS