Protein Info for Echvi_1269 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted signal-transduction protein containing cAMP-binding and CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 PF00027: cNMP_binding" amino acids 38 to 124 (87 residues), 53.2 bits, see alignment E=4.9e-18 PF00571: CBS" amino acids 178 to 226 (49 residues), 43.1 bits, see alignment 9e-15 amino acids 237 to 291 (55 residues), 24.4 bits, see alignment 6e-09 PF03445: DUF294" amino acids 322 to 462 (141 residues), 139.9 bits, see alignment E=1e-44 PF10335: DUF294_C" amino acids 501 to 641 (141 residues), 110.9 bits, see alignment E=9.6e-36

Best Hits

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY37 at UniProt or InterPro

Protein Sequence (648 amino acids)

>Echvi_1269 Predicted signal-transduction protein containing cAMP-binding and CBS domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNVIVNRVKEFLHRFPPFSFLSDELLTDVAREVELMYYTKGEYIFKKGNPASPHFFVLK
EGSVYLTEEDAGKMVVKDYCDEGEVFGVMALLGQRPYVLNGYVAEDSLIYAVPVDVFDKV
LKENSEVSLYFAAGFAAGQVVVRTDLSQSQKARKLLKDATSDHGLSLFMEKGKLNFPTDV
LSCPLGTPLREAARLMQEKDVGSIVVVDGTGHPSGIITDKDIRNRVVAAGIPYDVPVEEM
MTHPVRTVHHQSDFPTIYLTMIKNHLHHLILTEDGTDQSKITGIVSDHDVFLSHGNSPAV
LIHGLMNTWDVQEMKGIRDRAEALLGYFLENEVAIDFVANILSEINDVIIKRAVLLAKKK
LDQDFVEESKVPFCFLSLGSEGRQEQLLRTDLDNALVFEDVDEDKLPLTKAYFEALSQEV
IQTLIACGFHPCPSEVMANNPEWCQPLAVWKDYFSQWVNLPDEVALMKATIFFDFRPVYG
FKSLPEEMTRHIYQVIDERKAFLGFLAKNALLNPPPLGFFKNFIVEKSGEHKDQFDIKLR
AMMPLADAARLLILSHKVLGINNTFERFEKLAALEPQNASLYEEAASAYEIFLRLRALEG
IATGTSGRYITPRSLGKLQRQLLKNAFAPIQQIQEVLTVRFQTDYIPK