Protein Info for Echvi_1267 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: probable sodium:solute symporter, VC_2705 subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 372 to 397 (26 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 443 to 467 (25 residues), see Phobius details amino acids 475 to 493 (19 residues), see Phobius details amino acids 513 to 537 (25 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 7 to 558 (552 residues), 870.1 bits, see alignment E=5.8e-266 PF00474: SSF" amino acids 33 to 298 (266 residues), 120.8 bits, see alignment E=3.5e-39 amino acids 368 to 483 (116 residues), 71.2 bits, see alignment E=4e-24

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 71% identity to vco:VC0395_A2278)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWZ5 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Echvi_1267 probable sodium:solute symporter, VC_2705 subfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MDILTWTYILVGLSFALYIGIAIWSRAGSTKEFYVAGGGVSPLANGMATGADWMSAASFI
SMAGLISFMGYDGSVYLMGWTGGYVLLALLLAPYLRKFGKFTVPDFVGDRYYSNKARVVA
VFCAIFISFTYVAGQMRGVGIVFSRYLEVDINTGVIIGMCIVFFYAVLGGMKGITYTQVA
QYCVLIFAFMVPAIFISMQLTSNPIPQLGLGGTVADGTYLLDKLDGVLTDLGFHAYTSGK
KSMGDMFAITLALMVGTAGLPHVIVRFFTVPRVKDARLSAGYALVFIAILYTTAPAVSAF
GIYNAIDSVSEKPIDDLPEWVTNWQQTQLIKINDKNQDGVVQYVADPERNEFTIDKDIMV
LANPEIAQLPNWVVGLVAAGGMAAALSTAAGLLLVISTSVSRDLAKNFNPGISDKKELLI
ARVAAAVAVIVAGYFGVNPPGFVAEVVAFAFGLAAASFFPVIIMGIFSKRMNKEGAIWGM
LVGLVFTLSYIIYFKFGTDLFGIPAESLTAEHWWFGISPEGIGSIGMVLNFLVSFVVSRV
TPAPPEAVQEMVEDIRIPRGAGQAQGH