Protein Info for Echvi_1262 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: asparagine synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 TIGR01536: asparagine synthase (glutamine-hydrolyzing)" amino acids 2 to 528 (527 residues), 355.7 bits, see alignment E=2.7e-110 PF13522: GATase_6" amino acids 37 to 160 (124 residues), 106.7 bits, see alignment E=1.4e-34 PF13537: GATase_7" amino acids 47 to 164 (118 residues), 106.4 bits, see alignment E=1.5e-34 PF00733: Asn_synthase" amino acids 236 to 592 (357 residues), 213.3 bits, see alignment E=1.2e-66

Best Hits

Predicted SEED Role

"Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)" in subsystem Cyanophycin Metabolism or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.5.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWZ1 at UniProt or InterPro

Protein Sequence (598 amino acids)

>Echvi_1262 asparagine synthase (glutamine-hydrolyzing) (Echinicola vietnamensis KMM 6221, DSM 17526)
MCGINLAMNLPGSGEDAIQQMMAATAHRGPDHSDWCKITGQLFLAGNRLKTVDLSDWSNQ
PLQINQGAHTLVWNGALYNADELRNELLEDGESFESRSDSEVLLRWLKRHGISGINRLQG
MYALVFVEREEKSIIIARDPHGKKPLYYFHQNHLWLFSSEARGIIAAGQIKRQLDKTQLT
PYLYTRHSFPDKSFFQQVQQIVPGKALQLDFGGNIRAEHRTVIPQATLELPRKEHFRSLL
TDATLKHFRADIPVGVLLSGGADSSLLLDTWMRETDLPLHTFTARFEQKYLKKYQDPIHA
RQVAEKYRCVHHEVLITPALLRAQLPEYIASLDQPVGDSASFLSWMIAREAKEHVKILIS
GAGADELFGGYNRHEAFKQYLQHKAIALKASKVMGKLSFLGRHFQKIAKGIRKDEATTFL
NFSALRNIPADQREAFLAYYPKGVPPYKAALEWDRSYYLVNDILKIHDNALMAHGVEGRA
PYLDKNLVSLSMSLTEEQHLSLKPKQWIRELLRETGLEKVAVRKKFGFGLPLKEWLEEDQ
ALRSLVVETISGFVQQHHHSIPEEFHILAKEPDKKIKLHFLEIWNLYILAAWCTYHQL