Protein Info for Echvi_1261 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 94 to 112 (19 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 16 to 186 (171 residues), 76.4 bits, see alignment E=6.7e-25 PF13439: Glyco_transf_4" amino acids 16 to 191 (176 residues), 63.4 bits, see alignment E=5.4e-21 PF00534: Glycos_transf_1" amino acids 206 to 371 (166 residues), 45 bits, see alignment E=1.8e-15 PF13692: Glyco_trans_1_4" amino acids 215 to 356 (142 residues), 28 bits, see alignment E=4.7e-10

Best Hits

Predicted SEED Role

"putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW68 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Echvi_1261 Glycosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRIIYIHQYFVTPEEGGAVRSYHLAKGMVDAGMDVELITTHPNSQYLQKEIEGIKVHYLP
IPYDNNFGFLRRLRAFYAFVHQAKRLIKKLALPDLLYITSTPLTTGLIGLWAKRKLQLPF
IFEVRDLWPEAPVQVGVIRNSLLKRRLYTLEKSIYQEASQIVGLSPGICEYIQAILPKKR
VHLIPNFSDLDFFSPQAECNNHFLKRLGWEPNRLTIVYTGAIGDVNAVHELLQLADLAQQ
KGKNWQFAIMGKGKQLANLKAESKRLRLGNLQFIPFGNKGAVRMLLDHADFSFISFEHLP
VLRTNSPNKFFDAIAMGNAILINHKGWGWDLVHQHGLGLYFDHRNPQQALEELEKIEQNP
DRLRQMKQHSRHLAESRFSTSIAIEKLLKVLRENS