Protein Info for Echvi_1259 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methionine-R-sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00357: methionine-R-sulfoxide reductase
  • amino acids 24 to 146 (123 residues), 167.5 bits, E=7.6e-54
• PF01641: SelR
  • amino acids 33 to 145 (113 residues), 158.3 bits, E=3.6e-51

Best Hits

Swiss-Prot: 55% identical to MSRB_PSEPW: Peptide methionine sulfoxide reductase MsrB (msrB) from Pseudomonas putida (strain W619)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 73% identity to hhy:Halhy_3148)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

See L0FY29 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Echvi_1259 methionine-R-sulfoxide reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLNWSNVIHFATNGNPTPPQRVEKTPEEWQELLSPEQFKITRQKGTERAHSSDMCSLFEP
GKYACVCCDTLLFDAGEKFESGTGWPSFTQPVEESAIAYHKDVTFGMVRVEITCNTCDAH
LGHVFPDGPEPSGLRYCVNAVSLKKVS