Protein Info for Echvi_1255 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fatty acid hydroxylase superfamily.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 9 to 138 (130 residues), 52.5 bits, see alignment E=3.6e-18

Best Hits

Swiss-Prot: 31% identical to CRTZ_PARSN: Beta-carotene hydroxylase (crtZ) from Paracoccus sp. (strain N81106 / MBIC 01143)

KEGG orthology group: K02294, beta-carotene hydroxylase [EC: 1.14.13.-] (inferred from 44% identity to chu:CHU_2038)

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXS0 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Echvi_1255 Fatty acid hydroxylase superfamily. (Echinicola vietnamensis KMM 6221, DSM 17526)
MIEAILFIIIGFVAMEVSGWAIHKYLMHGVFWQIHKTHHHPRKGAFEKNDAFSAIFGGIA
IILMVMGYAALDYRFWLGMGISIYGMSYFFFHDVIIHRRVKWLKRPDGGFWRGFVRAHQA
HHANNQKKGTEAYGLFFVPFKYFKEGKK