Protein Info for Echvi_1252 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pantothenate kinase, type III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR00671: pantothenate kinase, type III" amino acids 2 to 251 (250 residues), 209.4 bits, see alignment E=3.5e-66 PF03309: Pan_kinase" amino acids 3 to 207 (205 residues), 184.9 bits, see alignment E=9.1e-59

Best Hits

Swiss-Prot: 41% identical to COAX_ROSS1: Type III pantothenate kinase (coaX) from Roseiflexus sp. (strain RS-1)

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 47% identity to dfe:Dfer_4140)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.33

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWY4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Echvi_1252 pantothenate kinase, type III (Echinicola vietnamensis KMM 6221, DSM 17526)
MFLSIDAGNSNIVFGFFSDEQQRWEPVLRVDTQRSLEFSYLQKNMNLFFLESHISPSDIS
IVGISSVVPEINENLKKVVRTFLHQEAYFITERSYSPLKVNTKKPAEMGADLMANAVAAY
DQYGADCIVVDFGTALTFTVIDSNGEILGVNIVPGLKTAIKSLFTNTSKLPEVQLELPVS
AIGKDTIHSIQAGILYGYAGLVRGMLEAIKNELARDFHVIATGGLSKILTNLEGEFDKID
KNLTLKGIKLITEKNL