Protein Info for Echvi_1246 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: gliding motility-associated protein GldE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details PF01595: CNNM" amino acids 27 to 200 (174 residues), 128.3 bits, see alignment E=4.1e-41 TIGR03520: gliding motility-associated protein GldE" amino acids 30 to 436 (407 residues), 596.5 bits, see alignment E=1.5e-183 PF00571: CBS" amino acids 220 to 278 (59 residues), 26.6 bits, see alignment E=9.3e-10 amino acids 293 to 339 (47 residues), 26 bits, see alignment 1.5e-09 PF03471: CorC_HlyC" amino acids 356 to 437 (82 residues), 60.6 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: None (inferred from 61% identity to mtt:Ftrac_2589)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW61 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Echvi_1246 gliding motility-associated protein GldE (Echinicola vietnamensis KMM 6221, DSM 17526)
MDDPYPSILLLAEINQVSAGYIITNSLIFLFLLLGSALVSGSEVAYFSLSHDDLNLLNTE
SDEKSALVIRLIEAPQRLLSTILILNNMINIGIVTLTTFFTLTLFGSNATGIVVVLIQTV
GITFAIVFFGEIVPKVYANNARVTFSKLMAKTLNFFSIILAPLSSFLMAISNIIERRIER
KGYTLSVNELHQALEITSENTTEGEKDIFKGIVNFGTLSVKQVMCSRMDITAVDVEMDFH
ELMDKINKSGYSRIPVYRETIDNIEGILYIKDLLTHIEKDEDFQWQTLTRKGFFVPENKK
VDALLKDFQNKRVHMAIVVDEYGGTSGLVTLEDLIEEIIGEINDEFDDDDDIFYKQIDDS
TFVFEGKVSLNDFCKKLELDSQIFDEVKGDSESLGGLLLELNAKFPNTGTKIQFEYFTFT
IMAVDARRIKKVKVHLEREEAKGAAHNED