Protein Info for Echvi_1243 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glutamate synthases, NADH/NADPH, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01317: glutamate synthase, NADH/NADPH, small subunit
  • amino acids 5 to 476 (472 residues), 679.8 bits, E=1.2e-208
• PF14691: Fer4_20
  • amino acids 23 to 130 (108 residues), 88.3 bits, E=1.9e-28
• PF07992: Pyr_redox_2
  • amino acids 145 to 458 (314 residues), 92.4 bits, E=2.2e-29
• PF12831: FAD_oxidored
  • amino acids 146 to 186 (41 residues), 28.8 bits, 4.8e-10
• PF00070: Pyr_redox
  • amino acids 146 to 218 (73 residues), 24.4 bits, E=2.1e-08
• PF00890: FAD_binding_2
  • amino acids 146 to 180 (35 residues), 26.6 bits, 2.2e-09
• PF13450: NAD_binding_8
  • amino acids 148 to 183 (36 residues), 35.8 bits, 4.9e-12
• PF01593: Amino_oxidase
  • amino acids 154 to 183 (30 residues), 25 bits, see alignment (E = 6.7e-09)

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 62% identity to mtt:Ftrac_2524)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See L0FUG7 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Echvi_1243 glutamate synthases, NADH/NADPH, small subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MGAKDGFLKYKRELESDRDRNERVKDYNDIHIPIKPETLNNQAARCMDCGIPFCHQGCPL
GNIIPEFNDAVYRKEWGEAWDILRSTNNFPEFTGRICPAPCEASCVLGINKDPVAIELIE
KNIAEKAYENDLAKPNIPETRTGKTVAVIGAGPAGMAAADQLNQAGHEVTLFEKDQKVGG
LLRYGIPDFKMEKWVIDRRVKLMEEEGVNFATGTEIGKTITADEILGKFDAVVLSTGAQE
PRDLKIKGREFNGVHFAMEFLGEQNRVVSGEREGDNPISAKGKHVIVIGGGDTGSDCIGT
SNRHGAASVTQLELLPKPPKQRAQLNPWPEWPMTLKTTTSHEEGAERVWSVLTKEFTKDD
KGNVKGLVLVDIEWKEENGRMQFVEVEGTERTVPCDLALLAIGYTGPKQNGLLEAFGVEA
MENSLPKSKEYQSTNNKVFLAGDMRRGQSLVVWAISEGREAAVKVDEFLMGKSNLPRKDK
SFFENVEDAEFCE