Protein Info for Echvi_1239 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA-binding regulatory protein, YebC/PmpR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 2 to 234 (233 residues), 291.7 bits, see alignment E=2.4e-91 PF20772: TACO1_YebC_N" amino acids 4 to 73 (70 residues), 93.7 bits, see alignment E=7.7e-31 PF01709: Transcrip_reg" amino acids 79 to 234 (156 residues), 198.4 bits, see alignment E=6.2e-63

Best Hits

Swiss-Prot: 62% identical to Y2560_FLAJ1: Probable transcriptional regulatory protein Fjoh_2560 (Fjoh_2560) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: None (inferred from 63% identity to zpr:ZPR_2585)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY07 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Echvi_1239 DNA-binding regulatory protein, YebC/PmpR family (Echinicola vietnamensis KMM 6221, DSM 17526)
MGRAFEFRKERKFKRWSKMSKVFTRLGKEIVTAVKLGGPDPDSNPKLRTVMQNAKGAAMP
KDRIEAAIKRASNKDQSNYEEVVYEGYAPHGVAILVEASTDNINRTVANVRHYFTKGGGS
LGTSGSVSFMFDHKAVFRFPKGEHDMEELELELIDFGLEDIDENEGEIFIYTEFEDFGNM
QKALEDKNIEVTSADFQRFPTTTVELTEEQEEEVNKMIERMEEDDDVNNVYHNIA