Protein Info for Echvi_1238 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01931: NTPase_I-T
  • amino acids 21 to 190 (170 residues), 209.9 bits, E=1.1e-66
• TIGR00258: inosine/xanthosine triphosphatase
  • amino acids 23 to 193 (171 residues), 139.1 bits, E=7.4e-45

Best Hits

Swiss-Prot: 40% identical to NCPP_VIBCM: Inosine/xanthosine triphosphatase (VCM66_0660) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_3465)

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See L0FUG3 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Echvi_1238 inosine/xanthosine triphosphatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MAFPKRKNIRPERQRERELLVVVGSKNPVKVQCTENGFQRAFSAHHFIVEGLNINSEVSD
QPFGDAETSLGAFNRAKNAKNTFPEADYWVGIEGGVEDLDDEMTAFAWVTIMDRNGVVGK
SKTATFILPEAIGKLIRGGMELGEADDKVFDRENSKQGNGAVGMLTKGTIDRKEYYEQAV
VLALIPFISDNLYT