Protein Info for Echvi_1231 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 349 (338 residues), 112.2 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: None (inferred from 62% identity to gfo:GFO_2207)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW46 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Echvi_1231 Arabinose efflux permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLRTSILPTIVVAQFCCTSLWFASNAVMADLLKNFSLESSALGHLTAAVQLGFIGGTFL
FALLALADCFSPSKVFCVCALLGSLANLGTLFDHNTLTSLIILRGLTGFFLAGIYPVGMK
IAADYFDKGLGKSLGFLVGALVLGTAFPHFLQAFTGTLSWQAVIIITSSLAVVGGGSLWL
LVPDGPYHKRAPRLNPTAAFTVFHKPAFRAAAFGYFGHMWELYAFWAFVPVMLQAYKALH
PDQIIHISLWSFLIIGIGSLGCIMAGLVAERWGTKRIASLALFFSGICCLIAPLMFLVDS
SSLFLVFLLVWGLTVVADSPLFSTLVAKNAPDHNKGTALTIVNCLGYSLTIVSIQLVNSL
RESFALSAIMCCLAIGPLFGLLSLWRNK