Protein Info for Echvi_1229 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12741: SusD-like" amino acids 27 to 314 (288 residues), 113.3 bits, see alignment E=1.6e-36 amino acids 409 to 466 (58 residues), 36.7 bits, see alignment 2.7e-13 amino acids 474 to 567 (94 residues), 68.4 bits, see alignment E=6.6e-23 PF12771: SusD-like_2" amino acids 72 to 508 (437 residues), 222 bits, see alignment E=1.3e-69

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXZ5 at UniProt or InterPro

Protein Sequence (568 amino acids)

>Echvi_1229 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNILHKTTLVGLMTSLTLGACTSNFEEMNTNPNLIGEDDASAKYFLTELMIRPYIPARYA
YWRANIIHTDRYAGHFTFGQNGNWWSDELGYSYNVAYTDAAWDHYNGLLGTVKQLLDFTQ
PGGAFENELTHAVVLILKSHYFQLYTDTFGMIPYSDVFSDEDISLPKFDTQKEIYMGIIA
DLDAAMAAIGDNTTTGDALENLGDNDVIYGGDLQKWKRFANTLKLKMAMRAQGAEGDDFS
QAAINEALAAPLLEEGESALIPKDLEISQWDYSTYGDIWHNFGAGSDWTVGEELVSFLRD
NNDPRLDQYVKPSEGGEFTLTRPDQAEDEEGYTLFPKRTNFLKEVFDEAGATYTWDDQGD
AIVINMPENTNYIGQPVRLSGEMSQLLPFGFFCKPSDMVIQQKNQGGSATPETVLLSAES
YFLQAEAALRGIGSGDAQELYQMGIKEAMRVWSVDDAAIDTYLAEEPMAQLNGTMEENLE
KLAIQRWIAHYTDGYEAWAIVRDTGYPASLAAGVSDYELYGPGTITAGGYPQRLRYGSSL
QASNPENYGDANSIQGPDMQGTKLWWAK