Protein Info for Echvi_1220 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details PF09976: TPR_21" amino acids 35 to 141 (107 residues), 25.5 bits, see alignment E=5e-09 PF07719: TPR_2" amino acids 150 to 178 (29 residues), 23 bits, see alignment (E = 3e-08) PF13181: TPR_8" amino acids 150 to 181 (32 residues), 21.2 bits, see alignment 1.1e-07 PF13176: TPR_7" amino acids 152 to 177 (26 residues), 15.2 bits, see alignment (E = 9.3e-06) PF13174: TPR_6" amino acids 152 to 176 (25 residues), 12.4 bits, see alignment (E = 0.00011) amino acids 192 to 220 (29 residues), 25.1 bits, see alignment (E = 9.9e-09)

Best Hits

KEGG orthology group: None (inferred from 47% identity to mtt:Ftrac_2509)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXL0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Echvi_1220 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKKEIKKGQHQEEHDHDLLENPEAIADSLGKGEAFLKKNSRVVGGIIIVGILVIAGILY
FQFDKANKDKQAQADMFQAVYYYEQDSLGLALNGDGVNDGFLTILDDYSGTNSANLAHFY
TGSIYLTQGEFQKAVDHLEEFSADDFFVQAKAYSLLGDAHMELGQTSDAISAYEKAANFK
ENKFFTPMYLNKLAIAYEAAGQVDKAISTYGKIEKNYPESYEFTLARKHKARLEGLASK