Protein Info for Echvi_1219 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00885: DMRL_synthase" amino acids 22 to 156 (135 residues), 192.6 bits, see alignment E=1.5e-61 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 23 to 156 (134 residues), 168.4 bits, see alignment E=4.6e-54

Best Hits

Swiss-Prot: 72% identical to RISB_CYTH3: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 79% identity to mtt:Ftrac_2508)

MetaCyc: 45% identical to 6,7-dimethyl-8-ribityllumazine synthase monomer (Bacillus subtilis)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXW7 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Echvi_1219 6,7-dimethyl-8-ribityllumazine synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MATSLKNLSQHSDTNITDISHKKFGIVVSEWNEEITESLYEGAVETLRTHGAKKENIYRK
NVPGSFELSLGAQWVAEVKEIDAVICLGCVIQGETKHFDFICDAVAHGITNVGLKYNKPV
IFGVLTPDNQQQALDRAGGKHGNKGDEAAITAIKMLGF