Protein Info for Echvi_1214 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 251 to 270 (20 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 312 to 328 (17 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details PF13387: DUF4105" amino acids 22 to 158 (137 residues), 111.8 bits, see alignment E=1.5e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXW1 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Echvi_1214 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKSVLIFTIILLNISQLYAKNYRVSLLTCAPGSELYSVFGHSAVRVTDMETGRDLVYNY
GTFDFDPSFYMKFARGKLDYWLSVATYDRFMEHYAYLGQAVREQELNLNEEQANKMVEFL
HINNQPDNRYYRYDFFYDNCATRIRDMMKTVLGEQLEWNDPVSEEQKTFRDLIDEYVYPL
PWGDLGIDLALGSVIDIDASEREKQFLPDYMEAAFGRAEIVGDGPTRPLVKHQSTLLDVP
PVAIAPNIFNPYFLFWGIAIMFIVITYMGYRKKRLFIGFDQAFFGVLAVLGIVVVLLWFF
TEHTATKYNWNMLWAFPLHGLLVYGLGMSSPAPWVKKYLLFALIMADAAVVFWILSWQSF
HPSVLPLILVVILRSNFLYYNLDKFKAHKRMVNS