Protein Info for Echvi_1206 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TIGR00730 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00730: TIGR00730 family protein" amino acids 55 to 232 (178 residues), 153.5 bits, see alignment E=2.4e-49 PF18306: LDcluster4" amino acids 56 to 171 (116 residues), 60.9 bits, see alignment E=1.2e-20 PF03641: Lysine_decarbox" amino acids 97 to 229 (133 residues), 117.5 bits, see alignment E=4.8e-38

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 77% identity to mtt:Ftrac_2499)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVZ7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Echvi_1206 TIGR00730 family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSEESEKTNLEEERIRKAFKEKDWSEIKSANSWVIFKVMSEFVEGFEKLAKIGPCVSIFG
SARTPQDNKYYKIAEEIAAKLVRHGYGVITGGGPGIMEAGNKGAHSEKGKSVGLNIQLPF
EQFNNMYIDQDKLITFDYFFVRKVMFVKYAQGFIVLPGGFGTMDELFEALTLVQTKKTGK
FPIILVGKEFWEGLIEWIKTIMLERHINISPEDMELFTLVDTATEAVEAIDEFYNKYLLS
PNF