Protein Info for Echvi_1203 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 29 to 58 (30 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 46 to 307 (262 residues), 171.5 bits, see alignment E=1.1e-54

Best Hits

KEGG orthology group: None (inferred from 53% identity to sli:Slin_6940)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUA1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Echvi_1203 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MDMEKAKFSLIRIRSIQQLLDRGLTIREILFWVAGLICLLPGMTAPLALVMGLLFANLLG
TPYATARTKATDYLLQFAVVGLGFGIGAADALQAGKSGFAMTIIAICCTLALGLTLGKFL
KIDRKTSLLVAVGTAICGGSAIAAVSPAIHARQHQISMALGAVFVLNSLALFLFPPIGKF
LGLSAGEFGTWCAIAIHDTSSVVGAASQYGKEALHIATTVKLARALWIIPVTFVAAMTFG
KGKGNIKIPYFIGFFILAVLANSYLPMANWMVTLIHQLSHTALCLSIFLIGCGLSKKLLL
AGGLRVLGQASILWVIISGMTLLVIINF