Protein Info for Echvi_1199 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methyltransferase domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF13489: Methyltransf_23" amino acids 26 to 137 (112 residues), 46.2 bits, see alignment E=1.5e-15 PF13847: Methyltransf_31" amino acids 27 to 134 (108 residues), 60.2 bits, see alignment E=7.3e-20 PF03848: TehB" amino acids 28 to 131 (104 residues), 31.4 bits, see alignment E=4.5e-11 PF01209: Ubie_methyltran" amino acids 30 to 133 (104 residues), 23.7 bits, see alignment E=9.6e-09 PF13649: Methyltransf_25" amino acids 32 to 130 (99 residues), 68.5 bits, see alignment E=2.3e-22 PF08241: Methyltransf_11" amino acids 33 to 134 (102 residues), 69.9 bits, see alignment E=8.6e-23 PF08242: Methyltransf_12" amino acids 33 to 132 (100 residues), 47.4 bits, see alignment E=9.3e-16

Best Hits

KEGG orthology group: None (inferred from 45% identity to cpi:Cpin_4275)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXU2 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Echvi_1199 Methyltransferase domain. (Echinicola vietnamensis KMM 6221, DSM 17526)
MNIAALNKLLGNIDIYLLDQILKGRFTKEMRILDAGCGEGRNLIYFLHEGFQVFGVDQNP
TAIQMARTYAKTIDKAYDPLRLQVAPVEDMPFHQGAFQAVISSAVLHFARDTAHFNAMFG
EMMRVLAPGGLLFLRMTTGFGGMEAASERIGEGTFQLLDGSTRFLLTDGLLREVMEKHTL
SHVEPPKSVLVHALRAMGVLVMTKES