Protein Info for Echvi_1197 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Ribosomal protein L11 methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF06325: PrmA" amino acids 33 to 275 (243 residues), 158.8 bits, see alignment E=4.4e-50 PF05175: MTS" amino acids 126 to 212 (87 residues), 37.3 bits, see alignment E=4.4e-13 PF13847: Methyltransf_31" amino acids 138 to 213 (76 residues), 33.3 bits, see alignment E=7.7e-12 PF13649: Methyltransf_25" amino acids 144 to 214 (71 residues), 30.1 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 48% identity to dfe:Dfer_3738)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Echvi_1197 Ribosomal protein L11 methylase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEYLEFKISCSQEFTEILMAELSEIGFDSFLETDDGVEAYVQEDLFDREAFDEVMGRYQE
MAQISLTEGKMPKVNWNEEWEKHYDPISIGNEVYVRASFHAPKEDVNHEILINPKMSFGT
GHHATTYLMLSHQLEVSHEGKSMVDIGSGTGILAIMAHKLGATHIEAFDIDNWCVENGNE
NFELNGMENVKMGHGTIREVSPKGPFDIVMANINKNVLLDEMEVYVSLMKPDAKLFLSGF
YEHDIPDLQYRAESLGLHLKGQKVKDNWAAIVFEKD