Protein Info for Echvi_1191 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type multidrug transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 38 to 308 (271 residues), 211.3 bits, see alignment E=2.3e-66 PF00005: ABC_tran" amino acids 372 to 521 (150 residues), 118.2 bits, see alignment E=4.3e-38

Best Hits

KEGG orthology group: None (inferred from 68% identity to mtt:Ftrac_2501)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVY1 at UniProt or InterPro

Protein Sequence (595 amino acids)

>Echvi_1191 ABC-type multidrug transport system, ATPase and permease components (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKKKKALEEHEKRKLNKKNLSKLIGIFNFVLPYKGIFIVGLIFLLFSSLTLLAFPYVAG
KLIDVAQGKKWMFSNINTIALVLIGILFVQSVFSFFRVWLFALVSERSMRDIRLSLYSRL
VNLPMSFFDKRRTGELISRITSDVSLLQDTFSVTLAELFRQIITLLAGTVFLFVTTPRLT
LFMLATFPVLVIIAMVFGKFIRKLSKETQDELAAANVIVEETLQSISTVKSFAGEAYEAA
RYGKGLNKVVKVALKAAGFRGAFISFIIFALFGGIVAVMWYGAMMVSTGAMSIGDLVSFV
LYTTFIGGSIAGLGDIYGQVQKAIGSSERVLEILDESPEESLADYQEVSIKGNVSFSDVS
FNYPTRPEADVLKHINISIQSGEKIALAGHSGAGKSTIIQLLMKFYTINFGEITIDDKPI
QNWNLKQLRSNIGIVPQEVLLFGGSIRENIAYAKPEATEQEIIEAAKKANAWQFIGKFPE
GLDTLVGERGIKLSGGQRQRIAIARAILKNPSILILDEATSSLDAESEALVQEALDELMK
NRTTIVIAHRLATIRKVDRIYVMKDGEIVEEGSHDDLAVQKGGFYANLVKLQFAE