Protein Info for Echvi_1176 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: MazG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00444: MazG family protein" amino acids 20 to 264 (245 residues), 278.7 bits, see alignment E=2.4e-87 PF03819: MazG" amino acids 34 to 106 (73 residues), 86.2 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 39% identical to MAZG_HAEIN: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 73% identity to dfe:Dfer_4447)

MetaCyc: 39% identical to phosphoribosyl-ATP diphosphatase (Desulfovibrio vulgaris)
Phosphoribosyl-ATP diphosphatase. [EC: 3.6.1.31]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.31

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.31 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVW3 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Echvi_1176 MazG family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKISSRSQQLEAFDRLLTIMDELREQCPWDRKQTIESLRHLTIEETFELSDAILDADLE
EVKKELGDILLHIVFYAKIGEEKGAFDIATVIESLCEKLIRRHPHIYGDTEANDDEAVKQ
NWEKIKLQEKGNKSVLGGVPRSLPALIKAMRIQEKARGVGFDWEDKAQVWEKVEEEMQEF
KEAFDVTAPEDIDRERATGEFGDVLFSLINYARFVDINPEEALEKTNRKFIYRFQYLEEA
AKKAGKNLGDMTLNEMDIFWNEAKKH