Protein Info for Echvi_1175 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Chloride channel protein EriC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 349 to 406 (58 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 72 to 429 (358 residues), 265.9 bits, see alignment E=5.9e-83 PF00571: CBS" amino acids 463 to 517 (55 residues), 29.3 bits, see alignment 8.6e-11 amino acids 528 to 581 (54 residues), 32.9 bits, see alignment 6.6e-12

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 58% identity to mtt:Ftrac_2158)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXG4 at UniProt or InterPro

Protein Sequence (591 amino acids)

>Echvi_1175 Chloride channel protein EriC (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKDIITQFLIWRLKHISTKNFMLILSGVIGILTGLASVILKVSVHSIQHWLIEGFQIEY
ANFFFILYPLVGIFLTYVVGKYIVNDYGGHGIPEILYNISKKKSLIPRVKMYSRVFTSCL
TVGLGGSVGLEAPIVVTGSAIGSNSGLLMHLNAKKRNILIGCGAAGGISAIFGSPIGGVI
FAIEVILMEVNTGAFIPLLIASVLGSLTTMVLIGNDPIFSFNLSGEFIAAHTPYYLLLGV
ITGLVSVYFIKAVLRTENLLEKQSNPWLKMLIGGAVLGLIIFFFPPIYGEGYNTLNSLIL
GDPAVLLNRSPFFSEINNTYFILFYLLMIIFAKPIAAALTIGSGGSGGIFAPSLYVGGIT
GFLFAFANNFFGIYIPIPVAHFTLVAMCGVMSGVQHAPLSAIFLIAEVTGGYELFVPLML
VSAISLATTNYFDKNSLYKNQLLEQGKHIPETKDEEVLGLIDIRRIMEKDLLPIHPDAVL
KDLCGLVKLSNRNIFPVVDEKGTLNGIITLDDIRDIMFDREKQNEVQIRKLMHSPPDTIQ
PSESMREVMDKFERSGAWNLPVVDNGIYLGFISKSRIFNAYRTRLIRQQRE