Protein Info for Echvi_1174 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fe2+/Zn2+ uptake regulation proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01475: FUR" amino acids 21 to 142 (122 residues), 86.5 bits, see alignment E=7.9e-29

Best Hits

KEGG orthology group: None (inferred from 65% identity to mtt:Ftrac_1613)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXR2 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Echvi_1174 Fe2+/Zn2+ uptake regulation proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MAEKSIVDKAKKIFENFLLRQGSRKTPERFSVIDELYALPQDEHIDVEGLFLRMRNKGYS
ISRATIYNTLDLLVECGLAVKHQFKDKVALYEQALTYKHHDHHVCNQCRKIREFSDERIN
LIKEAMGEEFSSAITSHSLVLYGDCQIPDCKNLKLV