Protein Info for Echvi_1163 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Endoglucanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF19190: BACON_2" amino acids 33 to 115 (83 residues), 41.7 bits, see alignment E=1.3e-14 PF13004: BACON" amino acids 57 to 114 (58 residues), 49.5 bits, see alignment 5.3e-17 PF00150: Cellulase" amino acids 153 to 445 (293 residues), 183.6 bits, see alignment E=8.5e-58

Best Hits

Predicted SEED Role

"Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization or Xylose utilization (EC 3.2.1.8)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.8

Use Curated BLAST to search for 3.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU56 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Echvi_1163 Endoglucanase (Echinicola vietnamensis KMM 6221, DSM 17526)
MHQNNRVVSLIFLFLLLGMEWACKSSEEEPSKLDVSSTRIELEADGESKEVSISSNTAWS
AHASANWINMTPSSGTGSQTVSIAALANTTPDSREAVVQIVAGSLQREIQVSQAAGKSHP
SYYIPADQTEMREISSLELAPELGIGWNLGNSLEAIGGETAWGNPAVTKELIDAVKAAGF
SAVRIPVAWSKFTDESSFTIDPAWAERVEEVVNYVLDNDLYAIINIHWDGGWMQPTYVAE
DAVNARLEAMWVQIALHFRDYDDHLLFAGTNEVMVDGDYGQPTPEYRTVQNGYNQTFVNA
VRGTGGRNAYRHLVVQSFNTNIDHAVDFMEMPVDEVKDRLMAEVHYYDPYEFALDADSPV
SEWGANADNPSKTAGWGGEAYATGQFKKMKSHFVDKGIPVIVGEYGAISKTNLEDHAVYR
AYYLEWITQAMLDQSLVPFYWDNGHTGNHGFGLFDRNNGEQVYPDLIDKITPSIN