Protein Info for Echvi_1162 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 PF17191: RecG_wedge" amino acids 9 to 160 (152 residues), 66.9 bits, see alignment E=4.9e-22 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 28 to 661 (634 residues), 719.7 bits, see alignment E=1.9e-220 PF01336: tRNA_anti-codon" amino acids 62 to 137 (76 residues), 39 bits, see alignment E=1.9e-13 PF04851: ResIII" amino acids 266 to 427 (162 residues), 40.9 bits, see alignment E=6.1e-14 PF00270: DEAD" amino acids 270 to 433 (164 residues), 88.8 bits, see alignment E=1.1e-28 PF00271: Helicase_C" amino acids 477 to 583 (107 residues), 60.8 bits, see alignment E=4.2e-20 PF19833: RecG_dom3_C" amino acids 612 to 697 (86 residues), 100.6 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 67% identity to mtt:Ftrac_1994)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWL1 at UniProt or InterPro

Protein Sequence (697 amino acids)

>Echvi_1162 ATP-dependent DNA helicase RecG (Echinicola vietnamensis KMM 6221, DSM 17526)
MPGFFDTKIEFLKGVGPQKAALLNKELDIYTFGELLQHYPFRYEDRTKFYKINQLSEHLE
HVQVIGKIRRLETIGMARKKRLVAYIEDETGEMELTWFKGIQWVAKKLVPGAVYVFFGKP
NRYGRKFSIAHPEMEPLTAAQEEKSFFQPVYPTTEKLRARYLDSKGISRIMDLLVQNAYP
HIQETLPSAIMERFNLMAKKDAIKQIHFPDDPDRLKRARFRLKFEEFFFVQLRLLKLKLT
RTEKFRGQILGQTELVGKFYTDHLPFELTNAQKRVIKEAFADMRSGKQMNRLIQGDVGSG
KTMVAFICALIAISSSTQACLMAPTEILATQHYEGLKEYADMMGLRIDLLTGSTKKSART
RIHGELLNGQLHILIGTHALLEDVVQFHNLGLAIVDEQHRFGVAQRAKLWAKNPNYYPHV
LVMTATPIPRTLAMTLYGDLDISVIDELPAGRKPIQTVHRYDKDRLKVFGFMKKEIELGR
QIYVVYPLIEESEKVDLKSLMDGYESIQRAFPQYPTSIVHGNMKPADKDFEMQRFVKGET
KIMVATTVIEVGVNVPNASVMVIENAERFGLSQLHQLRGRVGRGAEQSYCILMSKYELSK
DSRVRLDTMVRTNNGFEIADVDLKLRGPGDLMGTQQSGVADLIIADLSKDAPILTMARDA
AQQLIAEDPEISLPQHAMVLRQIKNQKKHAVNWSRIS