Protein Info for Echvi_1156 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: recF protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF13175: AAA_15" amino acids 1 to 97 (97 residues), 32.9 bits, see alignment E=1.1e-11 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 363 (363 residues), 272.8 bits, see alignment E=2.4e-85 PF02463: SMC_N" amino acids 3 to 345 (343 residues), 71.5 bits, see alignment E=1.4e-23 PF13476: AAA_23" amino acids 5 to 173 (169 residues), 39.6 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 48% identical to RECF_FLAJ1: DNA replication and repair protein RecF (recF) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 52% identity to dfe:Dfer_3886)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVU0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Echvi_1156 recF protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MHLKSLQLIQFKNYEKALVAFSPEINCFLGINGSGKTNMLDAIHYLSLTKSAFNPVDIQN
VRHDQGFFSMKGEFDKAGKSVEIQCILEARKKKQVFNNGKAYEKMSEHIGLLPVVLIAPD
DTSLIKEGSEERRKFFDSLLSQLDKNYLGKLVRYQHFLKQRNALIKQFVEQDRMDKNLLE
PYDVELIQLSKWLYEHRKAFIDRFKPYLLHHYAEISGEREAVEIRYESQCEKPDFEAYFY
GCLQRDLILKRTNAGVHKDDFIFEIDGHPLKKFGSQGQQKSFLIALKLAQFQVFKEETGT
KPLLLLDDIFDKLDDFRIGKMMELVAHHEFGQLFITDARPERTRKIMQDIEADIAYFHIE
GGKVSRQE