Protein Info for Echvi_1152 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GTP-binding protein HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR03156: GTP-binding protein HflX" amino acids 21 to 363 (343 residues), 406.1 bits, see alignment E=5.5e-126 PF13167: GTP-bdg_N" amino acids 37 to 124 (88 residues), 109.9 bits, see alignment E=1.8e-35 PF16360: GTP-bdg_M" amino acids 127 to 206 (80 residues), 94.6 bits, see alignment E=1.1e-30 PF00025: Arf" amino acids 207 to 351 (145 residues), 25.5 bits, see alignment E=2.1e-09 PF01926: MMR_HSR1" amino acids 211 to 329 (119 residues), 77.6 bits, see alignment E=2.1e-25 PF02421: FeoB_N" amino acids 211 to 338 (128 residues), 32.5 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 70% identity to mtt:Ftrac_2681)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWK1 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Echvi_1152 GTP-binding protein HflX (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKYTRKLKKLIDTAPVEETAVLVALIKQNQSEQEVEEHLDELAFLTETLGAKEVYRFTQ
RLEKPDVRSFVGSGKLEEIQAYVKHFEVDMVIFDDDLSPSQMRNLENELKVQVYDRSLLI
LDIFLNRAQTAQAKTQVELARFQYLLPRLTRMWTHLERQRGGTATRGGAGEKEIETDKRI
IRNQITLLKEKLRKIEKQGETQRKGRKGIVRVALVGYTNVGKSTLMNLVTKSDVLAENKL
FATVDSTVRKVVLENISFLLSDTVGFIRKLPTHLIESFKSTLMEIKESDLLVHVVDISHP
GFEDHIAVVNQTLNELGAGDKPVLLVFNKIDLVPKMPSEEALMNMSELEVEEANYLDLDR
LKNVYTKKMGIEPVFMAAQDGTNIETFRKSLVSQVKKQHKKIYPHYLESETYDLSQFDDM
E