Protein Info for Echvi_1151 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase" amino acids 4 to 174 (171 residues), 216.2 bits, see alignment E=1.4e-68 PF00908: dTDP_sugar_isom" amino acids 6 to 174 (169 residues), 231.8 bits, see alignment E=1.9e-73

Best Hits

Swiss-Prot: 50% identical to RMLC_SHIFL: dTDP-4-dehydrorhamnose 3,5-epimerase (rfbC) from Shigella flexneri

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 59% identity to lby:Lbys_3333)

MetaCyc: 46% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVT7 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Echvi_1151 dTDP-4-dehydrorhamnose 3,5-epimerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEIRSTPIQDVYELYPRVFNDARGYFLETYREDLLAERGINTQWVQDNQSFSIAGTVRGL
HFQHAPHAQAKLVRVVTGKVYDVCVDLRKDSPTFGQCHGVILDSAQHNMLYVPEGFAHGF
SVLEDAVFSYKCSNFYHKPSEGGIIWNDRQLDIDWKVGAPIISDKDLELPSLEEFKQQTG
GGL