Protein Info for Echvi_1146 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 154 to 183 (30 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details PF04018: VCA0040-like" amino acids 17 to 261 (245 residues), 357.2 bits, see alignment E=2.7e-111

Best Hits

KEGG orthology group: K08974, putative membrane protein (inferred from 54% identity to mtt:Ftrac_2673)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVT3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Echvi_1146 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MRHTKQYLLTFLKGMGMGAADIVPGVSGGTIALITGIYETLLDSIKSIDLDALKLLARFQ
LKALWKHINGSFLVALFLGIFTSIFTLSKLITYLMDEHPIPLWSFFCGLIIISSILILRD
IKRWNIMVILAIPVGAVIAYWVTGLNPVESPNALYFTFIAGAIAICAMILPGISGSFLLL
ILGKYEAILTAVTEKDFLTLGIFALGCLVGLLSFSRLISWLLKNHHAVTIAVLSGFMLGS
INKIWPWKKVVSYRISSSGEQKPFITENLFPNHYLTETGNEPQFFIGLLAFLFGILLVIG
LERMAFYLKKK