Protein Info for Echvi_1144 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glutamate decarboxylase and related PLP-dependent proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00282: Pyridoxal_deC
  • amino acids 92 to 337 (246 residues), 100.4 bits, E=9.4e-33
• PF00155: Aminotran_1_2
  • amino acids 137 to 241 (105 residues), 20.6 bits, E=2.4e-08

Best Hits

Swiss-Prot: 51% identical to TRPDC_CLOS1: Tryptophan decarboxylase (CLOSPO_02083) from Clostridium sporogenes (strain ATCC 15579)

KEGG orthology group: None (inferred from 48% identity to mtt:Ftrac_2647)

Predicted SEED Role

"L-tyrosine decarboxylase (EC 4.1.1.25)" (EC 4.1.1.25)

MetaCyc Pathways

• octopamine biosynthesis (1/2 steps found)
• salidroside biosynthesis (2/4 steps found)
• hydroxycinnamic acid tyramine amides biosynthesis (1/5 steps found)
• (S)-reticuline biosynthesis II (1/7 steps found)
• methanofuran biosynthesis (1/8 steps found)
• (S)-reticuline biosynthesis I (3/11 steps found)
• Amaryllidacea alkaloids biosynthesis (1/26 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Biosynthesis of alkaloids derived from shikimate pathway
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.25

Sequence Analysis Tools

See L0FXN1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Echvi_1144 Glutamate decarboxylase and related PLP-dependent proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MFWKKLSHEEVKKQIFGALAQNHNYRGEYPALGVPGTYLDTTEFYHDAPFLKDAPFMSVM
VQNPNHIGIHTLSEESVLDLFQGTQKIERDLINLVAEEVFAGEQGQQDGYVATGGTEANI
QAMWVYRNFFQAEYGAKTEEIAVVYSSDSHYSMPKGANLLNLHNIILEVDEETRQITQAS
LESKITEAKENGVKYFIVIANLSTTMFGSVDDVDRLGDFFTTANVTFRIHVDAAYGGFIY
PFTNEESTYTFQNPYITSFTSDGHKMLQTPYGTGLFLIRKGYIHHVCTEEAQYIPGKDYT
LCGSRSGANAVSMWMILKIHGSEGWKYKMASLCDRTERICTRLDRMGVKYFRNPHLNIIT
IKSEFISPRIAKKYNLVADSYEFKPKWYKIVVMHHVRQGVLDSFLMDLEGELVSKG