Protein Info for Echvi_1133 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerases 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF00254: FKBP_C" amino acids 3 to 86 (84 residues), 45 bits, see alignment E=5.6e-16

Best Hits

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 48% identity to chu:CHU_3430)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU22 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Echvi_1133 FKBP-type peptidyl-prolyl cis-trans isomerases 2 (Echinicola vietnamensis KMM 6221, DSM 17526)
MNAEKNKVISVAYELHVDDGENGKEFKEKVSKEQPFAFLFGAGNTLPSLEEAISGKQVGD
TFDVFIDYENAYGDYDESKVAIVPKSNFKEDGKKNKDLLKVGKVIPMQDDQGNHLRGEIT
KVDYKGVHMDFNSPLAGYDLHFKGEIVAIRDADPEEIEHGHVHGPGGHHH