Protein Info for Echvi_1116 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: protein-export membrane protein, SecD/SecF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 989 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details amino acids 520 to 539 (20 residues), see Phobius details amino acids 545 to 566 (22 residues), see Phobius details amino acids 590 to 612 (23 residues), see Phobius details amino acids 618 to 644 (27 residues), see Phobius details amino acids 678 to 699 (22 residues), see Phobius details amino acids 814 to 831 (18 residues), see Phobius details amino acids 840 to 865 (26 residues), see Phobius details amino acids 872 to 892 (21 residues), see Phobius details amino acids 919 to 940 (22 residues), see Phobius details amino acids 947 to 970 (24 residues), see Phobius details TIGR01129: protein-export membrane protein SecD" amino acids 83 to 642 (560 residues), 410.5 bits, see alignment E=1.3e-126 PF07549: Sec_GG" amino acids 83 to 98 (16 residues), 14.8 bits, see alignment (E = 4.1e-06) amino acids 695 to 719 (25 residues), 25.5 bits, see alignment (E = 1.8e-09) PF21760: SecD_1st" amino acids 184 to 243 (60 residues), 62.4 bits, see alignment 5.3e-21 PF22599: SecDF_P1_head" amino acids 377 to 473 (97 residues), 103.7 bits, see alignment E=1.3e-33 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 406 to 635 (230 residues), 248.3 bits, see alignment E=1.1e-77 amino acids 793 to 963 (171 residues), 154.5 bits, see alignment E=5.1e-49 PF02355: SecD_SecF_C" amino acids 476 to 647 (172 residues), 86.9 bits, see alignment E=3e-28 amino acids 787 to 975 (189 residues), 191.5 bits, see alignment E=2.6e-60 TIGR00966: protein-export membrane protein SecF" amino acids 698 to 966 (269 residues), 219 bits, see alignment E=1.3e-68

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 64% identity to mtt:Ftrac_1996)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVQ2 at UniProt or InterPro

Protein Sequence (989 amino acids)

>Echvi_1116 protein-export membrane protein, SecD/SecF family (Echinicola vietnamensis KMM 6221, DSM 17526)
MQNKGIIVFLTVIVTALCLYYLSFTYVSSNVQKDAIAYATDAEGNLDFAKKQSYLDSIWR
EPVYNFLGIEYTFKEVKETELGLGLDLQGGMHVTLAVSPVEIVKGLAGNSKNEAFNAAVD
EAEELSKTSNEKFVDLFYAAWKEKSGDKQLNTIYATAANRGRISLESSDSEILSIIDEEV
ENAIDRSFNILRTRIDRFGTSQPNIQRIQGTGRIQIELPGVDNQERVRNLLQGVAKLQFW
RVAEINEYGDALQRINAALVAEAKANKPAAAASADADTTGAASDTTMTDLERQLAEGGDE
TDSLSSEVSPLFSLLKANYGLVYNVKDTVTINRILNREDIKPLLPRGLTFMWSVKPREVD
GEELLELHAMETPRGTEQAPLEGDVITDAKQVLDQSSNPAVSMSMNADGARKWRKMTAEN
IGRRIAVVLDNYVYTAPNILGEIPSGQSEITGNFTIEEAKDLANILKSGTLPAPTNIVEE
AIIGPTLGKEAQAQGINSMVAGLVIVVLFMIAYYAKGGFVAIAALVFNIFFILGILAQLG
TALTLPGIAGIVLTIGMSIDANVLIFERIKEELAAGAGLLQAITSGYNKAFSAILDSNVT
TFLTGAILYALGQGPVKGFAIVLMIGIASSFFSAVFITRVIVYWMSKKGEQSKISFASPF
AKNLFSNLNIDFLGKRKVAYLISTGIIIIGLAFAVINGLKFGVDFTGGRSYIVEFAEPVA
ASDLKTGLDKAFDGSVEAKTYGSNNVIKITTSYLINDDSDEANSEVATKVREGIADVTGF
SFVDEVAQMGDSSFAITGSSKVGATVADDIKNSSMEAMFFALVAIFLYILLRFRKWQYSL
ASIIALAHDTLFVVAAFAIASAFGATFEIDQVFIAAMLTVIGYSINDTVIVFDRIRENIT
NRGTSKLVKMFNDAINQTMARTLITSFTTLIVVIVLLIFGGEVLRGFSFALFVGVLVGTY
SSIYIATPIVVDLMKREIAQEKEEAEKVA