Protein Info for Echvi_1110 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nicotinamide mononucleotide transporter PnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 155 to 171 (17 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details PF04973: NMN_transporter" amino acids 18 to 197 (180 residues), 208.6 bits, see alignment E=3.6e-66 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 18 to 201 (184 residues), 107 bits, see alignment E=5.8e-35

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 52% identity to cly:Celly_1011)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX89 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Echvi_1110 nicotinamide mononucleotide transporter PnuC (Echinicola vietnamensis KMM 6221, DSM 17526)
MDWQWIIDGFVAGLQQMTWLEAFAVVFGIASVFFSMKENIWVYPTGIISTLIYVWICLQV
KLYADMGINAYYFSMSIYGWYVWTHPKPGNAVLPVTWLKWKGWISAILLLIVSYGILYLV
LSTYTDSDVPYWDSFTTSSAFVGMYLMAKKKVENWIAWIITDLVSVPLYFYKGLVLTSFQ
FLFFTVLAVIGLIAWIKSAKAYAKAA