Protein Info for Echvi_1109 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted ATPase/kinase involved in NAD metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13521: AAA_28
  • amino acids 7 to 163 (157 residues), 134.6 bits, E=2.1e-43

Best Hits

KEGG orthology group: None (inferred from 58% identity to cpi:Cpin_0719)

Predicted SEED Role

"Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters (EC 2.7.1.22)

MetaCyc Pathways

• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• NAD salvage pathway IV (from nicotinamide riboside) (1/2 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.22

Use Curated BLAST to search for 2.7.1.22

Sequence Analysis Tools

See L0FXJ6 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Echvi_1109 Predicted ATPase/kinase involved in NAD metabolism (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKQPKKIVVIGPESTGKSTLSEALAAHYGVPWVAEYAREYIEQLDREYRYEDLLEIAKG
QINREEQKLKQAKSLLFCDTDLHVIHVWSEYKYHKTADWIMEQIAQRHYDLYLLTDIDIP
WEEDPQREYPDPEMRRFFYDWYERLMSTANAPVVNISGNLDQRLSKAITAIQHHLGKGV