Protein Info for Echvi_1106 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): transmembrane glucosamine N-acetyltransferase NagX
Rationale: Specifically important for glucosamine utilization. NagX proteins are distantly related to human HGSNAT (uniprot:Q68CP4), which is a transmembrane acetyl-CoA:alpha-glucosaminide N-acetyltransferase.
Original annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 5 to 230 (226 residues), 49.5 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: None (inferred from 48% identity to ter:Tery_1515)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVP4 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Echvi_1106 transmembrane glucosamine N-acetyltransferase NagX (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKQRILALDVFRGITIFAMILVNNPGSWSHVYAPLLHAKWHGCTPTDLIFPFFLFIVGV
AIELSLGGQLKKGTPKGFLLRKSLIRALKLIGLGLLLTAIPYFDLAHLRFPGVLQRIGLV
YFISTVMYLYWSPKALVFSSGILLIGYWLCMTFIPVPGIGPANLEPGTNLAAWIDQQVLT
GHMWSQTKTWDPEGLFSTLPAIVTCLLGVACGKILTGNSSHKARLTKWGIAGVTLVFGGL
AWSLFFPLNKALWTSSFVLYTAGWAFLGLAACYWILDVKGWKKWSLPFVIYGMNAITVFF
LSGVIAKLFGLIKVNWEGTRVSLKLFLQEALFNGWLAPKDASLCGAILMMIILFIPAYFM
WKRNIIIKV