Protein Info for Echvi_1101 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: N-acetylglutamate synthase and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 8 to 142 (135 residues), 37.2 bits, E=7.8e-13
• PF13673: Acetyltransf_10
  • amino acids 32 to 155 (124 residues), 107 bits, E=1.8e-34
• PF00583: Acetyltransf_1
  • amino acids 32 to 134 (103 residues), 58.8 bits, E=1.6e-19
• PF13508: Acetyltransf_7
  • amino acids 59 to 135 (77 residues), 54.4 bits, E=3.4e-18
• PF08445: FR47
  • amino acids 78 to 140 (63 residues), 25.2 bits, E=3.2e-09

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 46% identity to dfe:Dfer_1874)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See L0FVN7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Echvi_1101 N-acetylglutamate synthase and related acetyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNAYDIIIRQAELNDMIKVQQLYVETIQNSCKNDYSEEQIAAWISSVINEARWQQALKEE
FFLVAEYDEKIVGFGALKDDNYIDFMYIQHEYQRLGLAERLLKALEHQAKKNHSAEIIAD
ASKTAVPFFEKMGFRMVQENTKVVNGLELVNYRVEKAFLE