Protein Info for Echvi_1100 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00027: cNMP_binding" amino acids 38 to 123 (86 residues), 63.3 bits, see alignment E=2.5e-21 PF13545: HTH_Crp_2" amino acids 157 to 226 (70 residues), 50 bits, see alignment E=3.6e-17 PF00325: Crp" amino acids 179 to 209 (31 residues), 22.8 bits, see alignment 9.3e-09

Best Hits

KEGG orthology group: None (inferred from 62% identity to chu:CHU_1971)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX81 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Echvi_1100 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Echinicola vietnamensis KMM 6221, DSM 17526)
METHNPHCYTCTNTSCIIKRNCHLQEMAVFLEHKSTIRCKKGQNFIIEGAPIHGLYFINH
GKVKVAKTGLNGKEQIVRLTKDGDIIGHRGFGAGQAYHISATALEDTTLCNFSTEKMKEM
LQQLPSLSYDLMTFYAEELSRSETKVKKFAQMTVREKVIDAFLYINRKFGQKDGFFDVKL
SRKEIADFAGTTDEQVIRIISSLKKEGLIQASGRNLGIKNVELLRKEISEHNYFIDS