Protein Info for Echvi_1096 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nitrate transport ATP-binding subunits C and D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00005: ABC_tran" amino acids 23 to 164 (142 residues), 107.5 bits, see alignment E=4.4e-35 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 23 to 252 (230 residues), 292.2 bits, see alignment E=1.3e-91

Best Hits

Swiss-Prot: 47% identical to CMPD_SYNY3: Bicarbonate transport ATP-binding protein CmpD (cmpD) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 67% identity to chu:CHU_1967)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVN3 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Echvi_1096 nitrate transport ATP-binding subunits C and D (Echinicola vietnamensis KMM 6221, DSM 17526)
MAIIELNNVSKSFGMGASRVDVLSDINLQVAEGEFVAIVGFSGSGKTTLINLLNGLAFPD
QGEVLLHGQPVTGPGPDRGVIFQNYSLLPWLSVYNNVKLAVDEVFPQLSSKEKASHIKKY
IGMVNLTPAMDKLPKELSGGMRQRVSVARALAMNPEILLMDEPLSALDALTRGSLQEEII
RIWSQDKKTAILITNDVDEGILMADRIIPLTPGPKATLGPEFTIDIERPRDLSAINQNDD
YKKLRNEIIEYLIEVGASRKKSGDQHYILPDLKPVLPGRVFPGIKRKSEKVKYF