Protein Info for Echvi_1094 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acetyltransferases, including N-acetylases of ribosomal proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF13302: Acetyltransf_3" amino acids 16 to 155 (140 residues), 66.5 bits, see alignment E=4.2e-22 PF00583: Acetyltransf_1" amino acids 42 to 153 (112 residues), 24.7 bits, see alignment E=2.5e-09

Best Hits

KEGG orthology group: None (inferred from 58% identity to sdn:Sden_1154)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXH8 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Echvi_1094 Acetyltransferases, including N-acetylases of ribosomal proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MENHWLTPLTLKGEKVTLVPLQQAHRDGLIEAAADGKLWELWYTSVPSPETMDQYIEQAL
QQQAASTSLPFVIIDNASEKVVGCTRYCNAEAKHKRLEIGFTWYAKSVQRTGLNRECKYL
LLQHAFEKLDFICVQFKTDWFNLPSRNAIAKLGAKQDGILRNDRLNADGTYRDTVVFSII
QQEWHGVKKNLSYRMNHFIG