Protein Info for Echvi_1060 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methyltransferase domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF13489: Methyltransf_23" amino acids 88 to 239 (152 residues), 107.8 bits, see alignment E=1.2e-34 PF13847: Methyltransf_31" amino acids 100 to 200 (101 residues), 38 bits, see alignment E=3.5e-13 PF13649: Methyltransf_25" amino acids 104 to 188 (85 residues), 36.6 bits, see alignment E=1.5e-12 PF08242: Methyltransf_12" amino acids 104 to 190 (87 residues), 50.1 bits, see alignment E=9.5e-17 PF08241: Methyltransf_11" amino acids 104 to 191 (88 residues), 45.2 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: None (inferred from 51% identity to mtt:Ftrac_2377)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX42 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Echvi_1060 Methyltransferase domain. (Echinicola vietnamensis KMM 6221, DSM 17526)
MYERLTKCPLCQSGLFINHMVVKDHSVSKESFSICKCKNCQLLFTNPRPDASSISQYYQS
NDYISHTDKSTNLVNFIYKQVRKITLQQKVNWINKYTNHPNRLLDFGCGTGHFLEYAQSK
QWEVVGYEPSTEAAAVAKSKFNLKLYSELPELATEKKFDAITLFHVLEHIHDLKGTMEFL
LSKLKKRGTLYLAVPNNASYDATLFKEDWAALDVPRHLYHFTQETMHQLAKQYALKIVAE
EPMPFDSYYVSILSNSIKYNKKNLIKSIITGFKSNKLAKNNKNNYSSILFILKKK