Protein Info for Echvi_1040 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF18899: DUF5655" amino acids 13 to 121 (109 residues), 41.8 bits, see alignment E=1.5e-14 PF08818: DUF1801" amino acids 25 to 120 (96 residues), 70 bits, see alignment E=2.8e-23 PF13376: OmdA" amino acids 140 to 198 (59 residues), 74.9 bits, see alignment E=5.9e-25

Best Hits

KEGG orthology group: None (inferred from 47% identity to fba:FIC_02546)

Predicted SEED Role

"FIG00636098: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX25 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Echvi_1040 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MPDFHPSHDERIDAYIHTSQQFAEPILRHCRALVHQACPEVEETIKWGMPHFMLNGEILC
SMAAFKAHCAFVFWKAALMKDPALQQNAAEETAMGHLGKITHLKDLPSDEKMLAYLHEAV
EINKKGIPLPKKSPASKKALTVPDDLKAALEQNPASLNTFEQFSYTHQKEYIEWITEAKT
SATRTKRLHTAIAYMEAGKPRNWKYMKEWKNK